DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and CG6675

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster


Alignment Length:289 Identity:100/289 - (34%)
Similarity:148/289 - (51%) Gaps:37/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FYLYTKHNPTVGKEIRADASSIEDS--H--FDKNQGTRFVIHGWNGRYTDGMNVKITRAWLSKGD 125
            |||:.:..|..|:|:   ..|||..  |  |:.:..||.:||||..:.....|..:..|:|.||:
  Fly   120 FYLFKREFPECGREV---DFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKKGE 181

  Fly   126 YNVIVVNWDRAQ-SVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAG 189
            ||||||:|..:. :::|.|.|:.:...||::.:.|..|:.......:|:.:|||||||.:||.||
  Fly   182 YNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAG 246

  Fly   190 KQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKPIGKGTFYPNGGR 254
            |::...:|:||..||||.|.|.:...:.|:...||.||||:.|: ...||.:|.|..|||||.|.
  Fly   247 KRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTS-ANFGFRRPTGSATFYPNYGA 310

  Fly   255 NQPGCGSDIGGTCAHGRSVTYYVEAVT-----------EDNFGTIKCHDYQAALANECGSTYSGV 308
            .|..| ..:|  |:|.||...:.|::.           .|| |..:| ||         |....:
  Fly   311 YQHSC-YYLG--CSHIRSYQMFAESINSPLGFWGTPCIRDN-GRWQC-DY---------SQRQSI 361

  Fly   309 RMGAVTNAYMVDGDFYVPVNGQAPF--GK 335
            :|....:.:. :|.|||..:...||  ||
  Fly   362 QMAGEPSIHK-EGIFYVKTSSSDPFALGK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 96/278 (35%)
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 96/279 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D81025at33392
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.