DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and CG13282

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:288 Identity:95/288 - (32%)
Similarity:139/288 - (48%) Gaps:22/288 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DVSFYLYTKHNPTVGKEIRAD----ASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITRAWLS 122
            ||.:|:||:|||...:.:..|    .|::.||:|:....|:.:|||:|.........::...:|:
  Fly    76 DVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYNSDMFLHPLQQMREEYLA 140

  Fly   123 KGDYNVIVVNWD-RAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAG 186
            |.|||:|.|:|. .:....|||:|.....||....:::|.|.|   .....:.|||.||||.|..
  Fly   141 KADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVE---TGNTDIHVIGFSLGAQVPN 202

  Fly   187 YAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKPIGKGTFYPN 251
            |..:.:....:..|.|||||||||.......:|...||.||:.|.||...:|.::..|...||.|
  Fly   203 YIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGHADFYMN 267

  Fly   252 GGRNQPGC-GSDIGG-TCAHGRSVTYYVEAV-TEDNFGTIKCHDYQAALANECGST----YSGVR 309
            ||..|||| |..|.. .|:|.|:..|::|:: :...|....|..|.:.|...|..|    .:|..
  Fly   268 GGIMQPGCNGQKINSFACSHQRAPAYFLESIRSPKGFWGWACSGYISYLLGMCPPTNFLLEAGEN 332

  Fly   310 MGAVTNAYMVDGDFYVPVNGQAPF--GK 335
            :...|.     |.|.:..|..:||  ||
  Fly   333 IRPTTR-----GMFMIDTNDSSPFALGK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 90/277 (32%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 91/282 (32%)
Pancreat_lipase_like 75..347 CDD:238363 90/278 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.