DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and CG6431

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:279 Identity:83/279 - (29%)
Similarity:132/279 - (47%) Gaps:34/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VSFYLYTKHNPTVGKEIRA-DASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITR-AWLSKGD 125
            :.:.|:|.:.|..|..:.. :..::....|.|::.|.|:|||:||...| ::::..| |:||: |
  Fly    61 IDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAID-IHLQFLRDAYLSR-D 123

  Fly   126 YNVIVVNW-DRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAG 189
            :|||.|:| ...:...|:.|:...........::..:| .|:....|.:..:|||||||:.|...
  Fly   124 FNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFL-THYGAVRERITCVGHSLGAHICGMIS 187

  Fly   190 KQVGGKRVHTIVGLDPAMPLFAYDKPDK-RLSTEDAFYVESIQTNGGEKGFLKPIGKGTFYPNGG 253
            ..:..|: :.|:|||||.||....|.:| |||.:||..::.:.||.|..|.....|...:..|||
  Fly   188 NHLTRKQ-YRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGG 251

  Fly   254 RNQPGC-GSDI-GGTCAHGRSVTYYVEAVTEDN-FGTIKCHDYQAALANECGSTYSGVRMGAVTN 315
            |.||.| |:.| ...|:|..|:.|...|..:.| |..:.|       .|.|              
  Fly   252 RIQPFCKGNPIRKSRCSHFLSICYLATATFKHNKFMGVPC-------PNGC-------------- 295

  Fly   316 AYMVDGDFYVPVNGQA-PF 333
             ..:.|...:||:|:. ||
  Fly   296 -LNLSGSKRLPVSGKVNPF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 79/271 (29%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.