DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and CG18258

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster


Alignment Length:262 Identity:85/262 - (32%)
Similarity:126/262 - (48%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 FDKNQGTRFVIHGWNGRYTDGMNVKITRAWLSKGDYNVIVVNWDRAQSVDYISSVRA----VPG- 150
            |.:::.|...|.||.....:..:..:.:|:|.:.|.||:::  |.|..:|.:.:..|    |.| 
  Fly   201 FYQDRPTVLFITGWTTSINNSNSGPVAKAYLCRNDTNVLIL--DAANFIDTLYTWSALNTEVIGD 263

  Fly   151 --AGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGKQV----GGKRVHTIVGLDPAMPL 209
              |.|.:.....|:.:..||       :||||||.:||.||:..    ||:.:..|.|||||.|.
  Fly   264 YLAKALLRLNTSYVTKQFHL-------VGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPC 321

  Fly   210 FAYDKPD-KRLSTEDAFYVESIQTNGGEKGFLKPIGKGTFYPNGG-RNQPGCGSDIGGTCAHGRS 272
            | ||..: :.|.:.||.:|:.|.||.|..|..|..|...|:..|. ..:|||.|....:|:|.|:
  Fly   322 F-YDGNELEGLRSGDARFVDIIHTNPGMFGTSKRAGDADFFVQGRIPFKPGCESLDPISCSHQRA 385

  Fly   273 VTYYVEAVTEDN---FGTIKCHDY-QAALANECGSTYSGVRMGAVTNAYMVDGDFYVPVNGQAPF 333
            |.|:.|.|...|   |...:|..| :..|.|.|.:|  ...||....|..: |.|||..|.:.|:
  Fly   386 VDYWTETVYPSNGNDFLAKRCKRYSELLLGNYCKNT--NTVMGYAAKATDL-GLFYVGANPEEPY 447

  Fly   334 GK 335
            |:
  Fly   448 GQ 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 82/253 (32%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 82/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446076
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.