DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and Yp2

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster


Alignment Length:422 Identity:92/422 - (21%)
Similarity:161/422 - (38%) Gaps:99/422 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVFIALAALLATVSALPIEERVNGENGWYVPQIDGSFEWMDKQDAEELLN-------------- 51
            :|....:|.|||.....|.....:|.....:..::....|::.::.|||.|              
  Fly     4 LRTLCVMACLLAVAMGNPQSGNRSGRRSNSLDNVEQPSNWVNPREVEELPNLKEVTLKKLQEMSL 68

  Fly    52 -------------------------------RNSLIETRSNDVSFYLYT-----KHNPTVG-KEI 79
                                           |..::..|...:.|.|.|     |.....| .|:
  Fly    69 EEGATLLDKLYHLSQFNHVFKPDYTPEPSQIRGYIVGERGQKIEFNLNTLVEKVKRQQKFGDDEV 133

  Fly    80 RADASSIEDSHFDKNQGTRFVIHGWNGRY-------TDGMNVKITRAWLSK-------------- 123
            ......:.:::....:.||.::..:..||       ||..|.:.::...|:              
  Fly   134 TIFIQGLPETNTQVQKATRKLVQAYQQRYNLQPYETTDYSNEEQSQRSSSEEQQTQRRKQNGEQD 198

  Fly   124 ----GDYNVIVVNWDRA-QSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAH 183
                ||  :||:....| :..:..:::. :...|..:|..:..|....::..|.:.:||....||
  Fly   199 DTKTGD--LIVIQLGNAIEDFEQYATLN-IERLGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAH 260

  Fly   184 VAGYAGKQV---GGKRVHTIVGLDPAMPLFAYDKPDKR---LSTEDAFYVESIQTNGGEKGFLKP 242
            |||.||:|.   .|.::..|..|||..   .|.||::|   |:..||.:|::|.|:....|..:.
  Fly   261 VAGVAGRQFTRQTGHKLRRITALDPTK---IYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQR 322

  Fly   243 IGKGTFYPNG-GRNQPGCGSDIGGTCAHGRSVTYYVEAV---TEDNFGTIKCHDYQAALANECGS 303
            :....|:||| ....||..:.:..|.   |:..|:.|:|   .|.||.::....||....|: |.
  Fly   323 LANVDFFPNGPSTGVPGADNVVEATM---RATRYFAESVRPGNERNFPSVAASSYQEYKQNK-GY 383

  Fly   304 TYSGVRMGAVTNAYMVDGDFYVPVNGQAPFGK 335
            ...|. ||..|: :.:.||:.:.||.::|||:
  Fly   384 GKRGY-MGIATD-FDLQGDYILQVNSKSPFGR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 73/307 (24%)
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 77/325 (24%)
Abhydrolase <221..407 CDD:304388 55/195 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.