DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and Lipg

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:316 Identity:97/316 - (30%)
Similarity:153/316 - (48%) Gaps:55/316 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TRSNDVSFYLYTKHNP-------TVGKEIRADASSIEDSHFDKNQGTRFVIHGW--NGRYTDGMN 113
            |....|:|.:.|..:|       ::|     |:..:|:..|:....|.|:||||  :|.:...::
  Rat    46 TTKPSVTFNIRTSKDPEHEGCNLSLG-----DSKLLENCGFNMTAKTFFIIHGWTMSGMFESWLH 105

  Fly   114 VKITRAWLSKGDYNVIVVNW---DRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEV 175
            ..::.....:.:.||:||:|   .....:|.:|:.|.|   |.:|..|:.:|.|....|:..:.:
  Rat   106 KLVSALQTREKEANVVVVDWLPLAHQLYIDAVSNTRVV---GRRVAGMLNWLQEKGEFSLGDVHL 167

  Fly   176 IGHSLGAHVAGYAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTN----GGE 236
            ||:|||||||||||..|.| .|..|.|||||.|:|.....::|||.:||.:|:.:.|.    |..
  Rat   168 IGYSLGAHVAGYAGNFVKG-TVGRITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLS 231

  Fly   237 KGFLKPIGKGTFYPNGGRNQPGCG-SDIGGT-----------CAHGRSVTYYVEA-VTED--NFG 286
            .|...|:|....|||||..||||| :|:.|:           |.|.|:|..:|:: |.:|  :| 
  Rat   232 IGIRMPVGHIDIYPNGGDFQPGCGFNDVMGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSF- 295

  Fly   287 TIKCHD---YQAALA-----NECGST-YSGVRMGAVTNAYMVDGDFYVPVNGQAPF 333
            ..:|.|   ::..:.     |.|.:. |:..:|....|:.|     |:......||
  Rat   296 AFQCTDPNRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKM-----YLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 94/305 (31%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 94/305 (31%)
lipo_lipase 53..488 CDD:132274 95/309 (31%)
Heparin-binding. /evidence=ECO:0000250 327..339 4/16 (25%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338931
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.