DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and Lipc

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus


Alignment Length:268 Identity:81/268 - (30%)
Similarity:126/268 - (47%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DVSFYLYTKHNPTVGKEIRAD-ASSIEDSHFDKNQGTRFVIHGWNG-------------RYTDGM 112
            ::.|.|:...:..:|.::|.. ..::::..|:.:.....:||||:|             ...|| 
  Rat    48 EIRFLLFKDESDRLGCQLRPQHPETLQECGFNSSHPLVMIIHGWSGSESATVGKDSDNDSQVDG- 111

  Fly   113 NVKITRAWLSK----------GDYNVIVVNWDRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHH 167
               :...|:.|          ...||.:|:|.......|..:||.....|.:|..::.:|.|...
  Rat   112 ---LLETWIWKIVGALKSRQSQPVNVGLVDWISLAYQHYAIAVRNTRVVGQEVAALLLWLEESMK 173

  Fly   168 LSMESLEVIGHSLGAHVAGYAGKQVGGKR-VHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQ 231
            .|...:.:||:||||||:|:||..:|||| :..|.|||||.|:|....|::|||.:||.:|::|.
  Rat   174 FSRSKVHLIGYSLGAHVSGFAGSSMGGKRKIGRITGLDPAGPMFEGTSPNERLSPDDANFVDAIH 238

  Fly   232 T-----NGGEKGFLKPIGKGTFYPNGGRNQPGCG-------------SDIGGT--CAHGRSVTYY 276
            |     .|...|..:||....||||||..||||.             :.|..|  |||.|||..:
  Rat   239 TFTREHMGLSVGIKQPIAHYDFYPNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLF 303

  Fly   277 VEAVTEDN 284
            ::::...|
  Rat   304 IDSLQHSN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 81/268 (30%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 81/268 (30%)
Pancreat_lipase_like 47..362 CDD:238363 81/268 (30%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338956
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.