DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and Lipg

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_034850.3 Gene:Lipg / 16891 MGIID:1341803 Length:500 Species:Mus musculus


Alignment Length:313 Identity:96/313 - (30%)
Similarity:150/313 - (47%) Gaps:49/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TRSNDVSFYLYTKHNP-------TVGKEIRADASSIEDSHFDKNQGTRFVIHGW--NGRYTDGMN 113
            |....|:|.:.|..:|       ::|     |:..:|:..|:....|.|:||||  :|.:...::
Mouse    44 TARPSVAFNIRTSKDPEQEGCNLSLG-----DSKLLENCGFNMTAKTFFIIHGWTMSGMFESWLH 103

  Fly   114 VKITRAWLSKGDYNVIVVNWDRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGH 178
            ..::...:.:.|.||:||:|.......|..:|......|.:|..|:::|.|....|:.::.:||:
Mouse   104 KLVSALQMREKDANVVVVDWLPLAHQLYTDAVNNTRVVGQRVAGMLDWLQEKEEFSLGNVHLIGY 168

  Fly   179 SLGAHVAGYAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTN----GGEKGF 239
            |||||||||||..|.| .|..|.|||||.|:|.....::|||.:||.:|:.:.|.    |...|.
Mouse   169 SLGAHVAGYAGNFVKG-TVGRITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSIGI 232

  Fly   240 LKPIGKGTFYPNGGRNQPGCG-SDIGGT-----------CAHGRSVTYYVEA-VTED--NFGTIK 289
            ..|:|....|||||..||||| :|:.|:           |.|.|:|..:|:: |.:|  :| ..:
Mouse   233 RMPVGHIDIYPNGGDFQPGCGFNDVIGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSF-AFQ 296

  Fly   290 CHDYQ--------AALANECGST-YSGVRMGAVTNAYMVDGDFYVPVNGQAPF 333
            |.|..        :...|.|.:. |:..:|....|:.|     |:......||
Mouse   297 CTDSSRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKM-----YLKTRAGMPF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 93/302 (31%)
LipgNP_034850.3 Pancreat_lipase_like 49..340 CDD:238363 93/302 (31%)
lipo_lipase 51..485 CDD:132274 94/306 (31%)
Heparin-binding. /evidence=ECO:0000250 325..337 4/16 (25%)
PLAT_LPL 347..483 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835329
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.