DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:264 Identity:84/264 - (31%)
Similarity:125/264 - (47%) Gaps:25/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DVSFYLYTKHNPTVGKEIRA-DASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITRAWLSKGD 125
            |..|.|||..||...::|.| :..:|:.|:|..::.|||::||:..:..||..:.:.:.......
  Rat    66 DTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDKGEDGWLLDMCKKMFQVEK 130

  Fly   126 YNVIVVNWDRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGK 190
            .|.|.|:|.|....:|..:.......||::..:::.|......|.|::.:|||||||||.|.||:
  Rat   131 VNCICVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGEAGR 195

  Fly   191 QVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGE------KGFLKPIGKGTFY 249
            ::.| .|..|.|||||.|.|.....:.||...||.:|:.|.|:...      .|..:.:|...|:
  Rat   196 RLEG-HVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFF 259

  Fly   250 PNGGRNQPGCGS-------DIGG---------TCAHGRSVTYYVEAV-TEDNFGTIKCHDYQAAL 297
            ||||:..|||..       ||.|         .|.|.||..||..:: ..|.|....|..|:...
  Rat   260 PNGGKEMPGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQ 324

  Fly   298 ANEC 301
            .|:|
  Rat   325 QNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 84/264 (32%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 84/264 (32%)
Pancreat_lipase_like 65..363 CDD:238363 84/264 (32%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.