DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and LOC101884800

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:344 Identity:95/344 - (27%)
Similarity:142/344 - (41%) Gaps:67/344 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ENGWYV----------PQIDGSFE-----WMDKQDAEELLNRNSLIETRSNDVSFYLYTKHNPTV 75
            ||.|.:          |..:.:.|     :.|..|.|...:..| :|....|:.:.         
Zfish     4 ENFWLLLMGFSLIASEPIFNSTEEAFASNFTDYSDIESKFSIRS-VEFPDEDLCYL--------- 58

  Fly    76 GKEIRADASSIEDSHFDKNQGTRFVIHGWN--GRYTDGMNVKITRAWLSKGDYNVIVVNW-DRAQ 137
               :.....||.|.:|..:..|..:||||:  |.:...:...:|..:..:...|||||:| |||.
Zfish    59 ---VPGQQDSISDCNFKNDSQTFLIIHGWSVAGLFESWVYKLVTALYDREPSANVIVVDWLDRAN 120

  Fly   138 SVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGKQVGGKRVHTIVG 202
            . .|..|.......||.|.:.:.:|.|..: .:|.:.::|:||||||||.||.....| ||.|.|
Zfish   121 K-HYPKSAENTRLVGADVAKFVNWLEELDY-PLEKVHLLGYSLGAHVAGVAGNLTNNK-VHRITG 182

  Fly   203 LDPAMPLFAYDKPDKRLSTEDAFYVESIQTN--GGEK---GFLKPIGKGTFYPNGGRNQPGC--- 259
            ||||.|.|......:|||.:||.:|:.:.||  |...   |..:|:|....|||||..||||   
Zfish   183 LDPAGPSFENADILRRLSPDDASFVDVLHTNTRGSPDLSIGIQRPVGHVDIYPNGGTFQPGCSIQ 247

  Fly   260 ------------GSDIGGTCAHGRSVTYYVEAV-------------TEDNFGTIKCHDYQAALAN 299
                        ..|....|:|.||:..:::::             :.|:|....|...:....|
Zfish   248 HTMKLIATCGIYNMDQIVKCSHERSIHLFIDSLVNQAYQSWAFRCASRDSFNKGLCLSCRKNRCN 312

  Fly   300 ECGSTYSGVRMGAVTNAYM 318
            ..|.....:|....|..|:
Zfish   313 TLGYNVKKIRSTRSTKMYL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 85/293 (29%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 90/313 (29%)
Pancreat_lipase_like 39..335 CDD:238363 88/309 (28%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.