DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and LOC100331214

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:314 Identity:91/314 - (28%)
Similarity:142/314 - (45%) Gaps:57/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 WYVPQIDGSFEWMDKQDAEELLN---------RNSLIETRSNDVSFYLYTKHNPTVGKE-----I 79
            |.|..|.|.|  :...:...:||         ...|.:.:..:|.|.|   .||:...:     :
Zfish    12 WLVLNITGPF--IAALEEGNVLNGVFDHFLEDLRDLSDVKKLNVKFSL---RNPSQPDDDVCYIV 71

  Fly    80 RADASSIEDSHFDKNQGTRFVIHGW--NGRYTDGMNVKITRAWLSKGDYNVIVVNW-DRAQSVDY 141
            |..|.::...:|:....|..|||||  :|.:...:...:...:..:.|.|||||:| |.||. .|
Zfish    72 RGKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAALYNREKDANVIVVDWLDTAQD-HY 135

  Fly   142 ISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGKQVGGKRVHTIVGLDPA 206
            :.:.:.....|.::|..|:::.|..::.:|:|.:||:||||||||:||.....| :..|.|||||
Zfish   136 VVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHVAGFAGSHTTNK-IGRITGLDPA 199

  Fly   207 MPLFAYDKPDKRLSTEDAFYVESIQT-----NGGEKGFLKPIGKGTFYPNGGRNQPGCGSDIGGT 266
            .|.|.......|||.:||.:|:.:.|     .|...|..:|:|....|||||..||||  ::.|.
Zfish   200 GPDFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIEQPVGHVDIYPNGGSFQPGC--NLRGA 262

  Fly   267 -----------------CAHGRSVTYYVEAVTEDNFGTIKCHDYQAALANECGS 303
                             |.|.||:..:::::..:.         .|..|..|||
Zfish   263 LEKMASYGIFAINNAIRCEHERSIHLFIDSLLNEE---------AAGRAYSCGS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 83/272 (31%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 83/277 (30%)
Pancreat_lipase_like 51..347 CDD:238363 83/273 (30%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.