DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and lpl

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_002934038.1 Gene:lpl / 100127862 XenbaseID:XB-GENE-951545 Length:483 Species:Xenopus tropicalis


Alignment Length:327 Identity:89/327 - (27%)
Similarity:143/327 - (43%) Gaps:63/327 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SLIETRSNDV--SFYLYTKHNP-------TVGKEIRADASSIEDSHFDKNQGTRFVIHGW--NGR 107
            :|.:|..|.:  .|.|.|...|       ..|:|     .:::..:|:....|..|||||  .|.
 Frog    36 TLKKTDFNSIESKFSLRTLEEPDDDTCYLVPGQE-----HTVDQCNFNHTSKTFVVIHGWTVTGM 95

  Fly   108 YTDGMNVKITRAWLSKGDYNVIVVNW-DRAQ-----SVDYISSVRAVPGAGAKVGEMIEYLHEHH 166
            :...:...:...:..:.|.|||||:| .|||     |.:|...|      |..|...|:::.:..
 Frog    96 FESWVPKLVDALYKREPDSNVIVVDWLTRAQQHYPVSAEYTQLV------GQDVASFIDWMDDTI 154

  Fly   167 HLSMESLEVIGHSLGAHVAGYAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQ 231
            ...::::.::|:|||||.||.|| .:..|:|:.|.|||||.|.|.|.:....||.:||.:|:.:.
 Frog   155 QYPIDNIHILGYSLGAHAAGVAG-SLTNKKVNRITGLDPAGPTFEYAENAIILSPDDAEFVDVLH 218

  Fly   232 --TNGGEK---GFLKPIGKGTFYPNGGRNQPGCG-------------SDIGG--TCAHGRSVTYY 276
              |.|...   |..||:|....|||||..||||.             .|:..  .|:|.||:..:
 Frog   219 TYTRGSPDRSIGIQKPVGHIDIYPNGGSFQPGCNLGEALRLIAEKGFGDVDQLVKCSHERSIHLF 283

  Fly   277 VEAVTEDNFGTI--KCHDYQA--------ALANECGSTYSGVRMGAVTNAYMVDGDFYVPVNGQA 331
            ::::..:...::  :|:..:|        ...|.|.:.  |.::..|......  ..|:....|.
 Frog   284 IDSLLYEEKPSMAYRCNSKEAFEKGLCLSCRKNRCNTL--GYKVNKVRGKRST--KMYLKTRAQM 344

  Fly   332 PF 333
            ||
 Frog   345 PF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 83/312 (27%)
lplXP_002934038.1 lipo_lipase 41..476 CDD:132274 87/322 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.