DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and lipib

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:249 Identity:85/249 - (34%)
Similarity:128/249 - (51%) Gaps:15/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VSFYLYTKHNPTVGKEIRADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNV---KITRAWLSKG 124
            |...|||:.|...|:|: ...:..:...|:..:.|.|||||:  |.|....:   .|.....::.
Zfish    42 VRLLLYTRANLECGQEL-PHHNFTQQPLFNVTRPTTFVIHGY--RPTGAPPIWINHIVHLLAAQK 103

  Fly   125 DYNVIVVNWDR-AQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYA 188
            |.|::||:|:| |.:::|:::|....|....:...||.: |....|::|:.:||.||||||||:.
Zfish   104 DMNILVVDWNRGAANLNYLTAVANTRGTALNITRFIESM-EKEGASLDSIHLIGVSLGAHVAGFI 167

  Fly   189 GKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKPIGKGTFYPNGG 253
            |..:|| ||..|.|||||.|:||...|::||...||.:|:.:.|:....|.....|...||.|||
Zfish   168 GAMLGG-RVGRITGLDPAGPMFASVSPEERLDPTDAQFVDVLHTDMNSFGLRGTHGHIDFYANGG 231

  Fly   254 RNQPGCGSDIGG-----TCAHGRSVTYYVEAVTED-NFGTIKCHDYQAALANEC 301
            .:||||...|..     .|.|.|||..|:.::... :.....|..|...|:.:|
Zfish   232 LDQPGCPKTIFSGKSYFVCDHQRSVFLYLCSLNRTCSLTGYPCSSYSDFLSGQC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 85/249 (34%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 85/249 (34%)
Pancreat_lipase_like 40..324 CDD:238363 85/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.