DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and Pla1a

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_620237.1 Gene:Pla1a / 85311 RGDID:621261 Length:456 Species:Rattus norvegicus


Alignment Length:295 Identity:92/295 - (31%)
Similarity:142/295 - (48%) Gaps:31/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EVSFYLYTKQNPTEGQEITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVD-ITKAWLSKGD 125
            :|.|.|:|..:|..||.:..| |.|..|.||...||:.:|||::...|....:: ..:|.|...|
  Rat    50 KVQFLLFTPSDPGCGQLVEED-SDIRNSEFNASLGTKLIIHGFRALGTKPSWINKFIRALLRAAD 113

  Fly   126 FNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGK 190
            .|||.|:|....:..|..:|..|.....::...:..:.| ..:|..::.:||.||||||.|..|.
  Rat   114 ANVIAVDWVYGSTGMYFSAVENVVKLSLEISRFLSKLLE-LGVSESSIHIIGVSLGAHVGGMVGH 177

  Fly   191 ----QVGQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYVS 251
                |:|:     |.|||||.|.::..:.::||.|.||.:||:|.|:....|...|:|...::|:
  Rat   178 FYKGQLGR-----ITGLDPAGPEYTRASLEERLDSGDALFVEAIHTDTDNLGIRIPVGHVDYFVN 237

  Fly   252 GGRKQPGCGVDL-AG----TCSHARSVIYYAEAITENS--FGAIQCQDYQAALDNECGSSFSSVR 309
            ||:.||||...: ||    .|.|.|:|..|..|: ||:  ..|..|..|:|.|..:|...|:...
  Rat   238 GGQDQPGCPAFIHAGYSYLICDHMRAVHLYISAL-ENTCPLMAFPCASYKAFLAGDCLDCFNPFL 301

  Fly   310 MA------EDTNAYNVEG-----HFYVPVNSEAPF 333
            ::      .:.....:|.     ..|:...|.||:
  Rat   302 LSCPRIGLVERGGVKIEPLPKEVRVYLQTTSSAPY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 91/293 (31%)
Pancreat_lipase_like 62..329 CDD:238363 89/289 (31%)
Pla1aNP_620237.1 Lipase 14..336 CDD:278576 91/293 (31%)
Pancreat_lipase_like 49..332 CDD:238363 89/289 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.