DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:262 Identity:88/262 - (33%)
Similarity:124/262 - (47%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FYLYTKQNPTEGQEI-TADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAWLSKGDFNV 128
            |.|||.:|||..|.: .:|..:|.||:|.....|||:|||:..|..::..||:.|......:.|.
  Rat    56 FLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMCKNMFQVEEVNC 120

  Fly   129 IVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGKQV- 192
            |.|:|.:.....|..:...|...|.:|.:||..:.:|:..|...:.:|||||||||||.||.:. 
  Rat   121 ICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSKVHLIGHSLGAHVAGEAGSRTP 185

  Fly   193 GQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVK------GFVKPIGKAAFYVS 251
            |..|   |.||||....|.....:.||...||.:|:.|.|:....      |..:..|...|:.:
  Rat   186 GLGR---ITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLDFFPN 247

  Fly   252 GGRKQPGCG-------VDLAG---------TCSHARSVIYYAEAI-TENSFGAIQCQDYQAALDN 299
            ||:..|||.       ||:.|         .|:|.||..||.|:| ..:.|.|..|..|:....|
  Rat   248 GGQSMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAAYPCASYKDFESN 312

  Fly   300 EC 301
            :|
  Rat   313 KC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 88/262 (34%)
Pancreat_lipase_like 62..329 CDD:238363 88/262 (34%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 88/262 (34%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.