DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and Liph

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_038944552.1 Gene:Liph / 681694 RGDID:1592849 Length:476 Species:Rattus norvegicus


Alignment Length:289 Identity:90/289 - (31%)
Similarity:138/289 - (47%) Gaps:36/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TFQWMDKKDAKELLENISPLEFRSN------EVSFYLYTKQNPTEGQEITADASSIVASHFNKDH 95
            :|..:.|.|..|...:.:.|.|.|.      .|...|||:::.|..|.|    :|......|...
  Rat    46 SFMCLVKSDTDETCPSFTRLSFHSAVVGTGLSVRLMLYTQRDQTCAQVI----NSTALGSLNVTK 106

  Fly    96 GTRFVIHGWKGKYTDSMNV---DITKAWLSKGDFNVIVVNWAR-SQSVDYAMSVRAVPGAGTKVG 156
            .|.|:|||::.  |.|..|   ::.::.:|..:.||:||:|.| :.:|.|       |.|.:|..
  Rat   107 KTTFIIHGFRP--TGSPPVWMEELVQSLISVQEMNVVVVDWNRGATTVIY-------PHASSKTR 162

  Fly   157 EMIQYMHENHDM------SLETLEVIGHSLGAHVAGYAGKQVGQKRVHTIVGLDPALPLFSYDNP 215
            ::...:.|..|.      ||:.:.:||.|||||:||:.|:....| :..|.|||||.|||:...|
  Rat   163 KVALILKEFIDQMLAKGASLDNIYMIGVSLGAHIAGFVGEMYSGK-LGRITGLDPAGPLFNGRPP 226

  Fly   216 DKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYVSGGRKQPGCGVDLAG-----TCSHARSVIY 275
            :.||...||.:|:.|.::....|:.:.:|...||.:||..||||...:.|     .|.|..||..
  Rat   227 EDRLDPSDAQFVDVIHSDTDALGYREALGHIDFYPNGGLDQPGCPKTIFGGIKYFKCDHQMSVFL 291

  Fly   276 YAEAITEN-SFGAIQCQDYQAALDNECGS 303
            |..::..| |..|..|..|:...:.:|.|
  Rat   292 YLASLQNNCSITAYPCDSYRDYRNGKCVS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 86/271 (32%)
Pancreat_lipase_like 62..329 CDD:238363 83/258 (32%)
LiphXP_038944552.1 Pancreat_lipase_like 78..347 CDD:238363 83/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.