DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and pnliprp2

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001015812.1 Gene:pnliprp2 / 548529 XenbaseID:XB-GENE-5776210 Length:471 Species:Xenopus tropicalis


Alignment Length:254 Identity:83/254 - (32%)
Similarity:113/254 - (44%) Gaps:26/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FYLYTKQNPTEGQEITA-DASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAWLSKGDFNV 128
            |.|:||:||...|||.| ...:|..|:|.....|||:|||:.....|.....:....|...|.|.
 Frog    56 FLLFTKENPDTFQEIRALTPGAISTSNFKASRKTRFIIHGFIEHGYDRWLTHMCATLLKVEDVNC 120

  Fly   129 IVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGKQVG 193
            ..|:|.......|:.:...|...|.:|...||::...:..|...:.|||||||:|.||..||:. 
 Frog   121 FCVDWTGGAYALYSQAANNVRVVGAEVAHFIQFLSNQYGYSAANVHVIGHSLGSHAAGETGKRT- 184

  Fly   194 QKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGV------KGFVKPIGKAAFYVSG 252
             ..:..|.|||||.|.|....|:.||...||..|:.|.|:...      .|..:.:|...||.:|
 Frog   185 -PGIARITGLDPAGPFFQNTPPEVRLDQSDAQLVDVIHTDASAIFPLTGFGIGQSVGHLDFYPNG 248

  Fly   253 GRKQPGC----------------GVDLAGTCSHARSVIYYAEAI-TENSFGAIQCQDYQ 294
            |:..|||                |......|||.||..:|.|:| |.::|.|....||:
 Frog   249 GKNMPGCKKSPTLKYLDNYRIFKGSKEIIFCSHIRSYKFYTESILTPDAFVAFPSSDYK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 83/254 (33%)
Pancreat_lipase_like 62..329 CDD:238363 83/254 (33%)
pnliprp2NP_001015812.1 Lipase 18..352 CDD:278576 83/254 (33%)
PLAT 355..466 CDD:320707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.