DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and PNLIP

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:326 Identity:98/326 - (30%)
Similarity:147/326 - (45%) Gaps:38/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRELFFLAALL--VAGNALPIEERINGENGWFVPQEDGTFQWMDKKDAKELLENISPLEFRSNEV 63
            |..|:.|:.||  |||..: ..||:    |.|  .:|..:..:.::..     :|.|...:....
Human     1 MLPLWTLSLLLGAVAGKEV-CYERL----GCF--SDDSPWSGITERPL-----HILPWSPKDVNT 53

  Fly    64 SFYLYTKQNPTEGQEITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAWLSKGDFNV 128
            .|.|||.:||...||:.||:|||..|:|..:..|||:|||:..|..::...::.|........|.
Human    54 RFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNC 118

  Fly   129 IVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGKQVG 193
            |.|:|.......|..:.:.:...|.:|...::::......|...:.|||||||||.||.||::. 
Human   119 ICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRT- 182

  Fly   194 QKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGV------KGFVKPIGKAAFYVSG 252
            ...:..|.|||||.|.|.......||...||.:|:.|.|:|..      .|..:.:|...|:.:|
Human   183 NGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNG 247

  Fly   253 GRKQPGCG-------VDLAG---------TCSHARSVIYYAEAITE-NSFGAIQCQDYQAALDNE 300
            |.:.|||.       ||:.|         .|:|.||..||.::|.. :.|....|..|.....|:
Human   248 GVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANK 312

  Fly   301 C 301
            |
Human   313 C 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 84/270 (31%)
Pancreat_lipase_like 62..329 CDD:238363 83/263 (32%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 90/310 (29%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.