DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and CG4582

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:336 Identity:103/336 - (30%)
Similarity:158/336 - (47%) Gaps:44/336 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VPQEDGTFQWMDKKDAKE---------LLENISPLEFRSNEVSFYLYTKQNPTEGQEITA----- 81
            |||::...|....|..||         ::.|.....|..|     :..|.:..:.|:.|:     
  Fly    89 VPQDNANRQTGPLKSEKESPHRRLFQQVVGNTLTAAFGLN-----VMNKGDQEQNQQFTSEPVNL 148

  Fly    82 -DASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAW--LSKGDFNVIVVNWARSQSVDYAM 143
             ||:|:..|.|:..:.||.:||||.|....:|..::..|:  |..|::|:..|:|.|....||..
  Fly   149 YDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYIT 213

  Fly   144 SVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGKQVGQKRVHTIVGLDPALP 208
            :...|...|..:.:.:.::|:...|..|.|:::|.|:||||||.|||.:...|:..|..||||||
  Fly   214 ASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALP 278

  Fly   209 LFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYVSGGRKQPGCGVDLAGTCSHARSV 273
            .|.|..|.:||::|||.|||.:.|:.|..||.:|:|...||.:.|.:||||   ....|||.|:.
  Fly   279 FFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGC---FWHECSHWRAF 340

  Fly   274 IYYAEAITENSFGAIQCQDYQAALDNECGSSFSSVRMAEDTNAY--------NV--------EGH 322
            :.:||::..:.......|...||   |........|..:||...        ||        :|.
  Fly   341 MLFAESLARDQATGFLSQGCPAA---EWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGV 402

  Fly   323 FYVPVNSEAPF 333
            :|...|.:.|:
  Fly   403 YYFQTNDQPPY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 94/301 (31%)
Pancreat_lipase_like 62..329 CDD:238363 91/290 (31%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 90/276 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405444at33208
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.