DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and sxe2

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:306 Identity:97/306 - (31%)
Similarity:157/306 - (51%) Gaps:27/306 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PLEFRSNEVSFYLYTKQNPTEGQEI-TADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITK 118
            |...::..:.:.|||..||.|.|.: ..|.:.:..||||.....|..||||.||.....|..|..
  Fly    63 PRPSQTKLLRYDLYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIKD 127

  Fly   119 AWLSKGDFNVIVVNWARSQSVD--YAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLG 181
            |:||:|::|||:::|:| ||:|  |....:.:|.....|.:|::::|:|..:..|.:.:||||.|
  Fly   128 AYLSRGNYNVIILDWSR-QSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAG 191

  Fly   182 AHVAGYAGKQVGQKRVHTIVGLDPA-LPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKP--- 242
            :|::|..||.:...|:..|..|||| |...|. .|::||...||.|||||.|:..:.|  .|   
  Fly   192 SHISGLTGKLLRPHRLGAIFALDPAGLTQLSL-GPEERLDVNDALYVESIHTDLTLLG--NPSTK 253

  Fly   243 IGKAAFYVSGGRKQPGC----GVDLAGTCSHARSVIYYAEAITE-NSFGAIQCQDYQAALDNECG 302
            :..|:|:.:.|..||.|    ..:....|.|..::.|:||::.: .||.|::|...::.|...|.
  Fly   254 LSHASFFANWGLGQPHCPNATATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATCN 318

  Fly   303 SSF-SSVRMAEDTNAYN----------VEGHFYVPVNSEAPFGQTE 337
            .:. .|.:.|.:|...|          ..|.||:....::|:|.::
  Fly   319 CNVGGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPYGTSD 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 95/300 (32%)
Pancreat_lipase_like 62..329 CDD:238363 94/289 (33%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 95/300 (32%)
Pancreat_lipase_like 72..356 CDD:238363 94/287 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7804
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.