DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and LPL

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:314 Identity:95/314 - (30%)
Similarity:133/314 - (42%) Gaps:45/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EFRSNEVSFYLYTKQNPTEG--QEITADASSIVASHFNKDHGTRFVIHGW--KGKYTDSMNVDIT 117
            :|...|..|.|.|.::..|.  ..|...|.|:...|||....|..|||||  .|.|...:...:.
Human    33 DFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVA 97

  Fly   118 KAWLSKGDFNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGA 182
            ..:..:.|.|||||:|.......|.:|.......|..|...|.:|.|..:..|:.:.::|:||||
Human    98 ALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGA 162

  Fly   183 HVAGYAGKQVGQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQT-----NGGVKGFVKP 242
            |.||.|| .:..|:|:.|.|||||.|.|.|.....|||.:||.:|:.:.|     .|...|..||
Human   163 HAAGIAG-SLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKP 226

  Fly   243 IGKAAFYVSGGRKQPGCG---------------VDLAGTCSHARSVIYYAEAI--TENSFGAIQC 290
            :|....|.:||..||||.               ||....|||.||:..:.:::  .||...|.:|
Human   227 VGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRC 291

  Fly   291 QDYQA--------ALDNEC---GSSFSSVRMAEDTNAYNVEGHFYVPVNSEAPF 333
            ...:|        ...|.|   |...:.||....:.       .|:...|:.|:
Human   292 SSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSK-------MYLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 94/312 (30%)
Pancreat_lipase_like 62..329 CDD:238363 92/303 (30%)
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53 6/19 (32%)
Lipase 33..473 CDD:332983 95/314 (30%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266 3/22 (14%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.