DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and LIPC

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:313 Identity:84/313 - (26%)
Similarity:138/313 - (44%) Gaps:59/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FYLYTKQNPTEGQEITAD-ASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVD-ITKAWL------ 121
            |.|:.:.|  :|.:|..: ..::....||.......:||||        :|| :.:.|:      
Human    64 FLLFGETN--QGCQIRINHPDTLQECGFNSSLPLVMIIHGW--------SVDGVLENWIWQMVAA 118

  Fly   122 ----SKGDFNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGA 182
                .....||.:|:|.......|.::||.....|.:|..:::::.|:..:|...:.:||:||||
Human   119 LKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYSLGA 183

  Fly   183 HVAGYAGKQV-GQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQT-----NGGVKGFVK 241
            ||:|:||..: |..::..|.|||.|.|||....|..|||.:||.:|::|.|     .|...|..:
Human   184 HVSGFAGSSIGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQ 248

  Fly   242 PIGKAAFYVSGGRKQPGC---------------GVDLAGTCSHARSVIYYAEAI----TENSFGA 287
            |||...||.:||..||||               .:.....|||.|||..:.:::    |::.  |
Human   249 PIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSM--A 311

  Fly   288 IQCQDYQAALDNECGSSFSSVRMAEDTNAYNV-------EGHFYVPVNSEAPF 333
            ..|.|..:.....|   .|..:...:|..|:|       ....::...:::||
Human   312 YPCGDMNSFSQGLC---LSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 82/311 (26%)
Pancreat_lipase_like 62..329 CDD:238363 82/307 (27%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.