DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and lipca

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:323 Identity:82/323 - (25%)
Similarity:132/323 - (40%) Gaps:74/323 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FYLYTKQNPTEG-------QEITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVD-ITKAWL 121
            |.:||....||.       |..|.||..     ||.......:||||        :|| :.:.|:
Zfish    46 FRVYTDGEYTEDTCALELFQPHTLDACG-----FNSSLPLAIIIHGW--------SVDGMMEKWI 97

  Fly   122 SK---------GDFNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIG 177
            |:         |:.||::.:|.......|.::.:.....|..:..::.::.:.....|..:.:||
Zfish    98 SRLASALKSSEGNINVLIADWLTLAHQHYPIAAQNTRIVGQDIAHLLSWLEDFKQFPLGKVHLIG 162

  Fly   178 HSLGAHVAGYAGKQVGQ--KRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQT-----NGG 235
            :|||||::|:||..:..  :.:..|.|||||.|:|...:...|||.|||.:|::|.|     .|.
Zfish   163 YSLGAHISGFAGSNLAMSGRTLGRITGLDPAGPMFEGMSHTDRLSPEDAKFVDAIHTFTLQRMGL 227

  Fly   236 VKGFVKPIGKAAFYVSGGRKQPGC-----------------GVDLAGTCSHARSVIYYAEAI--T 281
            ..|..:|:....||.:||..||||                 |.:....|:|.|:|..:.:::  .
Zfish   228 SVGIKQPVAHFDFYPNGGSFQPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNK 292

  Fly   282 ENSFGAIQCQDYQA-----ALD---NEC---GSSFSSVRMAEDTNAYNVEGHFYVPVNSEAPF 333
            :....|.:|.|..|     .||   |.|   |.....||..:..       ..::...|..|:
Zfish   293 DKQIMAYKCSDNTAFDKGNCLDCRKNRCNTLGYDIKKVRTGKSK-------RLFLKTRSHMPY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 81/321 (25%)
Pancreat_lipase_like 62..329 CDD:238363 80/317 (25%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 82/323 (25%)
Pancreat_lipase_like 54..344 CDD:238363 77/309 (25%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.