DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and lipg

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:280 Identity:85/280 - (30%)
Similarity:131/280 - (46%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SIVASHFNKDHGTRFVIHGW--KGKYTDSMNVDITKAWLSKGDFNVIVVNWARSQSVDYAMSVRA 147
            ||||..||....|..:||||  .|.:...|:..:......:.:.||:||:|....:..|..:|..
Zfish    77 SIVACGFNATLRTILIIHGWTMSGMFESWMHKLVAAVQRRESEANVVVVDWLGLANQLYPDAVNH 141

  Fly   148 VPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGKQVGQKRVHTIVGLDPALPLFSY 212
            ....|..:..::.::.|...:.||.:.:||:|||||||||||..| ...:..|.|||||.|:|..
Zfish   142 TRRVGQSIATLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGTFV-NGIIGRITGLDPAGPMFEG 205

  Fly   213 DNPDKRLSSEDAFYVESIQ--TNG--GVK-GFVKPIGKAAFYVSGGRKQPGC--GVDLAGT---- 266
            .:...:||.:||.:|:.:.  |.|  ||. |..:|||....|.:||..||||  |..|:..    
Zfish   206 ADSYNKLSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCTFGEFLSAASGNF 270

  Fly   267 -----CSHARSVIYYAEAITEN---SFGAIQCQDYQ--------AALDNECGS-SFSSVRMAEDT 314
                 |.|.|:|..:.:::...   |: |.||....        :...|.|.| .:::.:|.:..
Zfish   271 MEAMKCEHERAVHLFVDSLMNKDHVSY-AFQCTGPDRFKKGICLSCRKNRCNSIGYNAKKMRKRR 334

  Fly   315 NAYNVEGHFYVPVNSEAPFG 334
            |:     ..|:...::.|||
Zfish   335 NS-----KMYLKTRADTPFG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 82/277 (30%)
Pancreat_lipase_like 62..329 CDD:238363 82/273 (30%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 85/280 (30%)
Pancreat_lipase_like 65..344 CDD:238363 82/273 (30%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.