DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and CG13562

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:310 Identity:65/310 - (20%)
Similarity:112/310 - (36%) Gaps:76/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RSNEVSFYLYTKQNPTEGQEITA--DASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITK--A 119
            ::.:|.||    :|.|:..|.:|  ||..:..|..:.......|:|||....:|...:.:.:  :
  Fly    59 KTMKVMFY----KNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLS 119

  Fly   120 WLSKG-----DFNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHS 179
            :...|     |::|:    |.|..:....:...:.||.:.:  ::....:..|.....:  .|.|
  Fly   120 YYRGGCVICIDYSVV----ASSSYMRLYTNFDTLTGAISSI--ILTLFRQGFDPKRGYM--FGFS 176

  Fly   180 LGAHVAGYAGKQVGQKRVHTIV-----------GLDPALPLFSYDNPDKRLSSEDAFYVESIQTN 233
            .|..:|...|:.:   |.|.|:           |.||    .:.|:      |:...:|:...::
  Fly   177 FGGQLASAVGRSL---RPHHIIESIDTCDMAGPGFDP----IAVDH------SKAGKHVQCFHSS 228

  Fly   234 GGVKGFVKPIGKAAFYVSGGRKQPGCGVDL-AGTCSHARSVIYYAEAITENSFGAIQCQDYQAAL 297
            .....||....:.....|.|.|||.....| .|  ||...|..|.     |:|      ||....
  Fly   229 RDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLG--SHGLCVDIYI-----NTF------DYPFYA 280

  Fly   298 DN----ECGSSFSSVRMAEDTNAY----------NVEGHFYVPVNSEAPF 333
            .|    ||   |:..:.|:..:.|          .|.|..:||.:...|:
  Fly   281 VNYTPPEC---FTWQKTAKIPDGYTVGYEENFDSQVTGQIFVPTSLHYPY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 64/308 (21%)
Pancreat_lipase_like 62..329 CDD:238363 64/301 (21%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 30/158 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.