DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and CG6472

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:291 Identity:91/291 - (31%)
Similarity:157/291 - (53%) Gaps:21/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EVSFYLYTKQNPTEGQEI-TADASSIVASHFNKDHGTRFVIHGWKGKYTD--SMNVDITKAWLSK 123
            ::.|.|||.:|....|.: .:|.:.:..|:||.::.....:||:....|.  ..:.::..|:|.:
  Fly    43 DIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRR 107

  Fly   124 GDFNVIVVNWARSQSVD-YAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGY 187
            |::|||:::|:...:|. |:.:|..:|.:|..:...::::.:. ....:.:.:||.||||.|||:
  Fly   108 GNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDK-GYPAKYIHLIGFSLGAEVAGF 171

  Fly   188 AGKQVGQ--KRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYV 250
            ||||:.:  .::..|..||||||||..::.::|||..||.:|:.|.|:||:.|...|:|.|.||.
  Fly   172 AGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYP 236

  Fly   251 SGGRK-QPGCG--------VDLAGTCSHARSVIYYAEAITE-NSFGAIQCQDYQA-ALDNECGSS 304
            :|||. ||||.        :.:...|||.|:..|:.|:|.: ..|.|.:|:.... .:..|.|..
  Fly   237 NGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFGICREPGGG 301

  Fly   305 FSSVRMAEDTNAYNVEGHFYVPVNSEAPFGQ 335
            .:.:.|..|.   .:.|.||:..|...|||:
  Fly   302 PAFMGMGADP---RIRGKFYLDTNDAKPFGR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 88/287 (31%)
Pancreat_lipase_like 62..329 CDD:238363 87/283 (31%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 87/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.