DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and CG13282

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:286 Identity:89/286 - (31%)
Similarity:141/286 - (49%) Gaps:24/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EVSFYLYTKQNPTEGQ----EITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNV----DITK 118
            :|.:|:||:.||.:.|    :.:.:.|::..|:||..:.|:.:|||    |...|.:    .:.:
  Fly    76 DVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHG----YNSDMFLHPLQQMRE 136

  Fly   119 AWLSKGDFNVIVVNWA-RSQSVDYAMSVRAVPGAGTKVGEMIQYMHE--NHDMSLETLEVIGHSL 180
            .:|:|.|:|:|.|:|: .|....|..:|.....|||...::::.:.|  |.|     :.|||.||
  Fly   137 EYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVETGNTD-----IHVIGFSL 196

  Fly   181 GAHVAGYAGKQVGQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPIGK 245
            ||.|..|..:.:....:..|.|||||:|||.......:|...||.||:.|.||..|:|.::..|.
  Fly   197 GAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGH 261

  Fly   246 AAFYVSGGRKQPGCGVDLAGT--CSHARSVIYYAEAI-TENSFGAIQCQDYQAALDNECGSSFSS 307
            |.||::||..||||......:  |||.|:..|:.|:| :...|....|..|.:.|...|..:...
  Fly   262 ADFYMNGGIMQPGCNGQKINSFACSHQRAPAYFLESIRSPKGFWGWACSGYISYLLGMCPPTNFL 326

  Fly   308 VRMAEDTNAYNVEGHFYVPVNSEAPF 333
            :...|:... ...|.|.:..|..:||
  Fly   327 LEAGENIRP-TTRGMFMIDTNDSSPF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 87/284 (31%)
Pancreat_lipase_like 62..329 CDD:238363 86/280 (31%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 87/284 (31%)
Pancreat_lipase_like 75..347 CDD:238363 86/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.