DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and CG6431

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:292 Identity:84/292 - (28%)
Similarity:129/292 - (44%) Gaps:36/292 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLENISPLEFRSNEVSFYLYTKQNPTEGQEITA-DASSIVASHFNKDHGTRFVIHGWKGKYTDSM 112
            ||....|..|    :.:.|:|...|..|..:.. :..::....|:|...|.|:|||:.|...|..
  Fly    51 LLWETCPKRF----IDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIH 111

  Fly   113 NVDITKAWLSKGDFNVIVVNW-ARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVI 176
            ...:..|:||: |||||.|:| ..::...|..|:...........::..:: .::....|.:..:
  Fly   112 LQFLRDAYLSR-DFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFL-THYGAVRERITCV 174

  Fly   177 GHSLGAHVAGYAGKQVGQKRVHTIVGLDPALPLFSYDNPDK-RLSSEDAFYVESIQTNGGVKGFV 240
            |||||||:.|.....:.:|: :.|:|||||.||......:| |||.:||..::.:.||.|..|..
  Fly   175 GHSLGAHICGMISNHLTRKQ-YRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQE 238

  Fly   241 KPIGKAAFYVSGGRKQPGC-GVDL-AGTCSHARSVIYYAEA-ITENSFGAIQCQDYQAALDNECG 302
            ...|...:.|:|||.||.| |..: ...|||..|:.|.|.| ...|.|..:.|       .|.| 
  Fly   239 DNSGHLNYCVNGGRIQPFCKGNPIRKSRCSHFLSICYLATATFKHNKFMGVPC-------PNGC- 295

  Fly   303 SSFSSVRMAEDTNAYNVEGHFYVPVNSEA-PF 333
                          .|:.|...:||:.:. ||
  Fly   296 --------------LNLSGSKRLPVSGKVNPF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 80/284 (28%)
Pancreat_lipase_like 62..329 CDD:238363 78/272 (29%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 72/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.