DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and CG17292

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:321 Identity:84/321 - (26%)
Similarity:142/321 - (44%) Gaps:45/321 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KDAKELLENISPLEFRSNEVSFYLYTKQNPTEGQ----EITADASSIVASHFNKDHGTRFVIHGW 104
            |:...||..:...:.......|.||  ..||...    ::|...|.:...|.:....|...:|| 
  Fly     6 KNKSRLLCGLKNSKADLTTAKFILY--YGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHG- 67

  Fly   105 KGKYTDSMNVD----ITKAWLSKGDFNVIVVNWARSQSVDYAMSVRAVPG---AGTKVGEMIQYM 162
               |.:..:|:    |.:|:|.:.|.|:||::|......:|...  |.|.   .|.::.:::..|
  Fly    68 ---YLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFD--AFPNLKQLGPELAKVLLKM 127

  Fly   163 HENHDMSLETLEVIGHSLGAHVAGYAGKQV-----GQKRVHTIVGLDPALPLFSYDNPDKRLSSE 222
            .: |.:.:|...::|||:|..:||..|:::     |.:::..|..||||.|||   .|...||:.
  Fly   128 FD-HGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF---YPGTHLSAN 188

  Fly   223 DAFYVESIQTNGGVKGFVKPIGKAAFYVSGGRK-QPGC---------GVDLAGTCSHARSVIYYA 277
            ||.:|:.|.|:..:.|.....|.|.|:.:||.. ||||         ..||:   ||.||..::|
  Fly   189 DAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLS---SHRRSWWFWA 250

  Fly   278 EAITEN---SFGAIQCQDYQAALDNECGSSFSSVRMAEDTNAYNVEGHFYVPVNSEAPFGQ 335
            |::::.   .|.|:..:.:.....|:...:...|.|...... .:.|.||:..|...||.:
  Fly   251 ESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVVMGHHCPT-TIHGDFYLQTNGHTPFAR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 79/306 (26%)
Pancreat_lipase_like 62..329 CDD:238363 78/295 (26%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 78/295 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.