DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and Lipg

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:315 Identity:95/315 - (30%)
Similarity:151/315 - (47%) Gaps:63/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VSFYLYTKQNPT-EGQEITADASSIVAS-HFNKDHGTRFVIHGW--KGKYTDSMNVDITKAWLSK 123
            |:|.:.|.::|. ||..::...|.::.: .||....|.|:||||  .|.:         ::||.|
  Rat    51 VTFNIRTSKDPEHEGCNLSLGDSKLLENCGFNMTAKTFFIIHGWTMSGMF---------ESWLHK 106

  Fly   124 ---------GDFNVIVVNW---ARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVI 176
                     .:.||:||:|   |....:|...:.|.|   |.:|..|:.::.|..:.||..:.:|
  Rat   107 LVSALQTREKEANVVVVDWLPLAHQLYIDAVSNTRVV---GRRVAGMLNWLQEKGEFSLGDVHLI 168

  Fly   177 GHSLGAHVAGYAGKQVGQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQT---NGGVK- 237
            |:|||||||||||..| :..|..|.|||||.|:|...:.::|||.:||.:|:.:.|   :.|:. 
  Rat   169 GYSLGAHVAGYAGNFV-KGTVGRITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSI 232

  Fly   238 GFVKPIGKAAFYVSGGRKQPGCGV-DLAGT-----------CSHARSVIYYAEAITEN---SFGA 287
            |...|:|....|.:||..|||||. |:.|:           |.|.|:|..:.:::...   || |
  Rat   233 GIRMPVGHIDIYPNGGDFQPGCGFNDVMGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSF-A 296

  Fly   288 IQCQDYQ--------AALDNECGS-SFSSVRMAEDTNAYNVEGHFYVPVNSEAPF 333
            .||.|..        :...|.|.: .:::.:|.:..|:     ..|:...:..||
  Rat   297 FQCTDPNRFKRGICLSCRKNRCNNIGYNAKKMRKKRNS-----KMYLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 93/313 (30%)
Pancreat_lipase_like 62..329 CDD:238363 93/309 (30%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 93/309 (30%)
lipo_lipase 53..488 CDD:132274 94/313 (30%)
Heparin-binding. /evidence=ECO:0000250 327..339 3/16 (19%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338932
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.