DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and Lipi

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:304 Identity:95/304 - (31%)
Similarity:155/304 - (50%) Gaps:23/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PQEDGTFQWMDKKDAKELLENISPLEFRSNEVSFYLYTKQNPTEGQEITADASSIVASHFNKDHG 96
            |:.:.|.....|.:|   :.::..|.:.:.:::..:|::.| .:..|...::::.|.:.||....
  Rat    31 PENNRTCLEFSKSNA---MNSLKDLFYPTVKINLLMYSRNN-AKCAEPLFESNNSVNARFNPSKK 91

  Fly    97 TRFVIHGWKGKYTDSMNV-DITKAWLSKGDFNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQ 160
            |.::|||::...:..|.: ..|||:|.:.|.|:|||:|  :|.....:..|||... .||.|:::
  Rat    92 TIWIIHGYRPLGSTPMWIHKFTKAFLKQEDVNLIVVDW--NQGATTFIYGRAVKNT-RKVAEILR 153

  Fly   161 YMHEN---HDMSLETLEVIGHSLGAHVAGYAGKQVGQKRVHTIVGLDPALPLFSYDNPDKRLSSE 222
            ...||   |..||:....||.|||||:.|:.|| :.|.::..|.|||||.|.||....:.||...
  Rat   154 EYIENLLIHGASLDNFHFIGMSLGAHICGFVGK-LFQGQLGRITGLDPAGPKFSGKPSNCRLDYT 217

  Fly   223 DAFYVESIQTNGGVKGFVKPIGKAAFYVSGGRKQPGCGVDLAG-----TCSHARSVIYYAEAITE 282
            ||.:|:.|.::....|.::|.|...||.:|||.||||...|..     .|.|.|:|..:.||...
  Rat   218 DAKFVDVIHSDSQGFGILEPSGHIDFYPNGGRNQPGCPTSLLSGMDYIKCDHQRAVHLFLEAFET 282

  Fly   283 N-SFGAIQC---QDYQAALDNECGSSF--SSVRMAEDTNAYNVE 320
            | :|.:..|   :||::.|...||:.:  |..|:....|.:..|
  Rat   283 NCNFVSFPCRSYRDYKSGLCVGCGNLYKDSCPRLGIQANLWKEE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 91/281 (32%)
Pancreat_lipase_like 62..329 CDD:238363 90/274 (33%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 90/275 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.