DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and Pnlip

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:276 Identity:87/276 - (31%)
Similarity:128/276 - (46%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SPLEFRSNEVSFYLYTKQNPTEGQEITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITK 118
            ||.:..:.   |.|||.:|....|:||:|||||..|:|..:..||.:|||:..|..::...|:.|
  Rat    47 SPAQINTR---FLLYTNENQDNYQKITSDASSIRNSNFKTNRKTRIIIHGFIDKGEENWLSDMCK 108

  Fly   119 AWLSKGDFNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAH 183
            ........|.|.|:|.......|..:.:.|...|.:|..::..:..:...|.:.:.:||||||:|
  Rat   109 NMFKVESVNCICVDWKGGSRATYTQATQNVRVVGAEVALLVNVLKSDLGYSPDNVHLIGHSLGSH 173

  Fly   184 VAGYAGKQ----VGQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQT-------NGGVK 237
            |||.|||:    :|:     |.|||.|.|.|.....:.||...||.:|::|.|       |.|. 
  Rat   174 VAGEAGKRTFGAIGR-----ITGLDAAEPYFQGTPEEVRLDPTDAQFVDAIHTDAAPIIPNLGF- 232

  Fly   238 GFVKPIGKAAFYVSGGRKQPGCG-------VDLAG---------TCSHARSVIYYAEAITE-NSF 285
            |..:.:|...|:.:||.:.|||.       ||:.|         .|:|.||..||.::|.. ..|
  Rat   233 GMSQTVGHLDFFPNGGMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPTGF 297

  Fly   286 GAIQCQDYQAALDNEC 301
            ....|..|.....|:|
  Rat   298 SGFSCSSYNVFSANKC 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 86/275 (31%)
Pancreat_lipase_like 62..329 CDD:238363 85/268 (32%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 87/276 (32%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.