DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and LIPH

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:332 Identity:98/332 - (29%)
Similarity:152/332 - (45%) Gaps:57/332 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MDKKDAKELLENISPLEFRSN------EVSFYLYTKQNPTEGQEITADASSIVASHFNKDHGTRF 99
            :.:.||:|...:.:.|.|.|.      .|...|||::|.|..|.|.:.|    ..:.|....|.|
Human    13 LSRSDAEETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSSA----FGNLNVTKKTTF 73

  Fly   100 VIHGWKGKYTDSMNV---DITKAWLSKGDFNVIVVNWAR-SQSVDYAMSVRAVPGAGTKVGEMIQ 160
            ::||::.  |.|..|   |:.|..||..|.||:||:|.| :.::.|.       .|.:|..::..
Human    74 IVHGFRP--TGSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYT-------HASSKTRKVAM 129

  Fly   161 YMHENHDM------SLETLEVIGHSLGAHVAGYAGKQ----VGQKRVHTIVGLDPALPLFSYDNP 215
            .:.|..|.      ||:.:.:||.|||||::|:.|:.    :|:     |.|||||.|||:....
Human   130 VLKEFIDQMLAEGASLDDIYMIGVSLGAHISGFVGEMYDGWLGR-----ITGLDPAGPLFNGKPH 189

  Fly   216 DKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYVSGGRKQPGCGVDLAG-----TCSHARSVIY 275
            ..||...||.:|:.|.::....|:.:|:|...||.:||..||||...:.|     .|.|.|||..
Human   190 QDRLDPSDAQFVDVIHSDTDALGYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYL 254

  Fly   276 YAEAITEN-SFGAIQCQDYQAALDNECGSSFSSVRMAEDTNAY---NVEGHF----------YVP 326
            |..::.|: :..|..|..||...:.:|.|..:|.:.:.....|   |.:.|.          :..
Human   255 YLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHLRGKDPPMTKAFFD 319

  Fly   327 VNSEAPF 333
            ...|:||
Human   320 TAEESPF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 93/316 (29%)
Pancreat_lipase_like 62..329 CDD:238363 89/299 (30%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 88/281 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.