DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 / 18947 MGIID:1336202 Length:482 Species:Mus musculus


Alignment Length:322 Identity:100/322 - (31%)
Similarity:151/322 - (46%) Gaps:34/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFFLAALLVAGNALPIEERINGENGWFVPQEDGTFQWMDKKDAKELLENISPLEFRSNEVSFYLY 68
            |.:|.:||:|  .:..:|...|..|.|  ..|..:..|.::.:|     |.|......:..|.||
Mouse    17 LCWLVSLLLA--TVGGKEVCYGHLGCF--SNDKPWAGMIQRPSK-----IFPWSPEDIDTRFLLY 72

  Fly    69 TKQNPTEGQEITA-DASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAWLSKGDFNVIVVN 132
            |.:||...|.|:| |.::|.||:|..|..|||:|||:..|..:...:|:.|........|.|.|:
Mouse    73 TNENPNNYQIISATDPATINASNFQLDRKTRFIIHGFIDKGEEGWLLDMCKKMFQVEKVNCICVD 137

  Fly   133 WARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGKQVGQKRV 197
            |.|....:|..:.......|.::..::|.:......|.|.:.:||||||:||||.||::: :..|
Mouse   138 WKRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGSHVAGEAGRRL-EGHV 201

  Fly   198 HTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGV------KGFVKPIGKAAFYVSGGRKQ 256
            ..|.|||||.|.|.....:.||...||.:|:.|.|:...      .|..:.:|...|:.:||::.
Mouse   202 GRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGKEM 266

  Fly   257 PGCG-------VDLAG---------TCSHARSVIYYAEAI-TENSFGAIQCQDYQAALDNEC 301
            |||.       ||:.|         .|:|.||..|||.:| ..:.|....|..|:....|:|
Mouse   267 PGCQKNILSTIVDINGIWEGTRNFAACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQHNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 87/271 (32%)
Pancreat_lipase_like 62..329 CDD:238363 86/264 (33%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 95/306 (31%)
Pancreat_lipase_like 65..363 CDD:238363 86/265 (32%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 106..118 4/11 (36%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 270..292 3/21 (14%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.