DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_061362.1 Gene:Pnliprp1 / 18946 MGIID:97723 Length:473 Species:Mus musculus


Alignment Length:262 Identity:90/262 - (34%)
Similarity:125/262 - (47%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FYLYTKQNPTEGQEI-TADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAWLSKGDFNV 128
            |.|||.:|||..|.: .:|.|:|.||:|.....|||:|||:..|..::..||:.|......:.|.
Mouse    56 FLLYTNENPTAFQTLQLSDPSTIEASNFQVARKTRFIIHGFIDKGEENWVVDMCKNMFQVEEVNC 120

  Fly   129 IVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGKQV- 192
            |.|:|.|.....|..:...|...|.:|.:||..:..|.:.|...:.:|||||||||||.||.:. 
Mouse   121 ICVDWKRGSQTTYTQAANNVRVVGAQVAQMIDILVRNFNYSASKVHLIGHSLGAHVAGEAGSRTP 185

  Fly   193 GQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVK------GFVKPIGKAAFYVS 251
            |..|   |.||||....|.....:.||...||.:|:.|.|:....      |..:.:|...|:.:
Mouse   186 GLGR---ITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMVGHFDFFPN 247

  Fly   252 GGRKQPGCG-------VDLAG---------TCSHARSVIYYAEAI-TENSFGAIQCQDYQAALDN 299
            ||:..|||.       ||:.|         .|:|.||..||.|:| ..:.|.|..|..|:....|
Mouse   248 GGQYMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAAYPCASYRDFESN 312

  Fly   300 EC 301
            :|
Mouse   313 KC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 90/262 (34%)
Pancreat_lipase_like 62..329 CDD:238363 90/262 (34%)
Pnliprp1NP_061362.1 Lipase 18..353 CDD:278576 90/262 (34%)
Pancreat_lipase_like 52..349 CDD:238363 90/262 (34%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.