DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and Lipc

DIOPT Version :9

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:333 Identity:88/333 - (26%)
Similarity:146/333 - (43%) Gaps:55/333 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ENISPLEFRSNEVSFYLYTKQNPTEGQEITAD-ASSIVASHFNKDHGTRFVIHGWK-------GK 107
            |...||  :..|..|.|:..:|...|..:... ..::....||.......:||||.       ||
Mouse    39 EASKPL--KKPETRFLLFQDENDRLGCRLRPQHPETLQECGFNSSQPLIMIIHGWSGSESATVGK 101

  Fly   108 YTDS-MNVD-ITKAWLSK----------GDFNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQ 160
            .:|| ..|| :.:.|:.|          ...||.:|:|.......|.::|:.....|..|..::.
Mouse   102 DSDSDYQVDGLLENWIWKIVSALKSRQSQPVNVGLVDWISLAYQHYTIAVQNTRIVGQDVAALLL 166

  Fly   161 YMHENHDMSLETLEVIGHSLGAHVAGYAGKQV-GQKRVHTIVGLDPALPLFSYDNPDKRLSSEDA 224
            ::.|:...|...:.:||:||||||:|:||..: |:.::..|.|||||.|:|...:|::|||.:||
Mouse   167 WLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGKNKIGRITGLDPAGPMFEGTSPNERLSPDDA 231

  Fly   225 FYVESIQT-----NGGVKGFVKPIGKAAFYVSGGRKQPGC---------------GVDLAGTCSH 269
            .:|::|.|     .|...|..:||....||.:||..||||               .:.....|:|
Mouse   232 NFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAH 296

  Fly   270 ARSVIYYAEAITENSFGAI--QCQDYQAALDNECGSSFSSVRMAEDTNAYNV-------EGHFYV 325
            .|||..:.:::..:...:|  ||.|..:.....|   .|..:...:|..|::       ....::
Mouse   297 ERSVHLFIDSLQHSDLQSIGFQCSDMGSFSQGLC---LSCKKGRCNTLGYDIRKDRSGKSKRLFL 358

  Fly   326 PVNSEAPF 333
            ...:::||
Mouse   359 ITRAQSPF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 85/327 (26%)
Pancreat_lipase_like 62..329 CDD:238363 83/316 (26%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 86/331 (26%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.