DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and Liph

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_038944552.1 Gene:Liph / 681694 RGDID:1592849 Length:476 Species:Rattus norvegicus


Alignment Length:262 Identity:87/262 - (33%)
Similarity:125/262 - (47%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTH---- 124
            |...|||..::...|.|.:|:.   || .|....|.|.|||:..:       |....|...    
  Rat    78 VRLMLYTQRDQTCAQVINSTAL---GS-LNVTKKTTFIIHGFRPT-------GSPPVWMEELVQS 131

  Fly   125 ----GDMNMIAVDWGR-ARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAH 184
                .:||::.|||.| |.:|.|..:......|...:...|:.|.:. |.:|||..:||.|||||
  Rat   132 LISVQEMNVVVVDWNRGATTVIYPHASSKTRKVALILKEFIDQMLAK-GASLDNIYMIGVSLGAH 195

  Fly   185 VSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAF 249
            ::|:.|: :.:|:|..|.|||||.|||:...|..||..:||.:|:.|.::...||:.:.:|...|
  Rat   196 IAGFVGE-MYSGKLGRITGLDPAGPLFNGRPPEDRLDPSDAQFVDVIHSDTDALGYREALGHIDF 259

  Fly   250 YPNGGKSQPGCGVDLTG-----SCAHSRSVIYYAESVTENN-----FPTMRCGDYEEAVAKECGS 304
            |||||..||||...:.|     .|.|..||..|..|: :||     :|.....||.......||:
  Rat   260 YPNGGLDQPGCPKTIFGGIKYFKCDHQMSVFLYLASL-QNNCSITAYPCDSYRDYRNGKCVSCGA 323

  Fly   305 SY 306
            .:
  Rat   324 GH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 87/262 (33%)
LiphXP_038944552.1 Pancreat_lipase_like 78..347 CDD:238363 87/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.