DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and PNLIP

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:268 Identity:99/268 - (36%)
Similarity:129/268 - (48%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAW--------F 122
            |.||||.|.|:.||:.|.|:|||||:|..|..|||.|||       ||:.| .:.|        |
Human    55 FLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHG-------FIDKG-EENWLANVCKNLF 111

  Fly   123 THGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSG 187
            ....:|.|.|||.......|..:...:..||.:||..:.|::|..|.:..|..|||||||||.:|
Human   112 KVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAG 176

  Fly   188 YAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTL------GFLKPIGK 246
            .||:.. ||.:..|.|||||.|.|.......||..:||.:|:.|.|:|..:      |..:.:|.
Human   177 EAGRRT-NGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH 240

  Fly   247 GAFYPNGGKSQPGCG-------VDLTG---------SCAHSRSVIYYAES-VTENNFPTMRCGDY 294
            ..|:||||...|||.       ||:.|         :|.|.||..||.:| |..:.|....|..|
Human   241 LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASY 305

  Fly   295 EEAVAKEC 302
            ....|.:|
Human   306 NVFTANKC 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 99/268 (37%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 99/268 (37%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145318
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.