DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and liph

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001011098.1 Gene:liph / 496511 XenbaseID:XB-GENE-5847665 Length:460 Species:Xenopus tropicalis


Alignment Length:267 Identity:92/267 - (34%)
Similarity:128/267 - (47%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTH---- 124
            |...|||..|....|::...: |....:.|....|.|..||:..:       |....|...    
 Frog    47 VQLLLYTRENPKCAQDLNVDN-STGFQYLNVTRRTVFITHGYRPT-------GSPPVWIDDIVKK 103

  Fly   125 ----GDMNMIAVDWGR-ARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAH 184
                .|.|:|.|||.| |.:|.|.::......|.:.:...|:.|.| .|..||:..::|.|||||
 Frog   104 FLDIQDFNVIVVDWNRGATTVLYHNAAANTRKVADILKRFIDNMLS-QGATLDSIYMVGVSLGAH 167

  Fly   185 VSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAF 249
            :||:.|| :.||.:..|.|||||.|||:...|.:||..|||.:|:.:.::...||:.:.:|...|
 Frog   168 ISGFVGK-MYNGSIGRITGLDPAGPLFNGKPPEERLHYTDAQFVDVVHSDTDGLGYKESLGHIDF 231

  Fly   250 YPNGGKSQPGC-GVDLTGS----CAHSRSVIYYAESVTENNFPTMRCGDYEEAVAKECGSSYSSV 309
            |||||..|||| ...|.||    |.|.|||..|..|:|::      |    :.||..| .||...
 Frog   232 YPNGGTDQPGCPKTILAGSEYFKCDHQRSVFLYIASLTKS------C----DLVAFPC-KSYRDY 285

  Fly   310 RMGATTN 316
            |:|..|:
 Frog   286 RIGNCTD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 92/267 (34%)
liphNP_001011098.1 Pancreat_lipase_like 45..312 CDD:238363 92/267 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.