DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and lipia

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:290 Identity:97/290 - (33%)
Similarity:136/290 - (46%) Gaps:41/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LETKNRMEGRNVLNPVTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHG--------- 104
            |..|:.:.|.::  .|...|||.::.:..| :.:.....|.|.||.:..|.|.|||         
Zfish    32 LNFKDSLAGTSL--KVRLLLYTRADPSCGQ-LLSHQEPFSNSQFNVSSVTTFLIHGYRPTGSPPV 93

  Fly   105 WSSSKDEFINYGVRDAWFTHGDMNMIAVDWGR-ARSVDYASSVLAVPGVGEQVATLINFMRSNHG 168
            |.....||:        ....|||:|.|||.| |.:::|...|.....|...:..||..|:.| |
Zfish    94 WMKQFVEFL--------LNRRDMNVIVVDWNRGATNMNYWQVVKNTRKVANNLTDLIQKMKDN-G 149

  Fly   169 LNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQT 233
            .||.:..:||.|||||:||:.|.|. ||::..|..||||.|.|:...|..||..:||.:||::.|
Zfish   150 ANLSSIHMIGVSLGAHISGFTGANF-NGEIGRITALDPAGPEFNGRPPEDRLDPSDALFVEALHT 213

  Fly   234 NGGTLGFLKPIGKGAFYPNGGKSQPGC-GVDLTGS----CAHSRSVIYYAESVTEN----NFPTM 289
            :...||:...:|...:|.|||..|||| ...|:||    |.|.|||..|..||..:    .:|..
Zfish   214 DMDALGYRNLLGHIDYYANGGADQPGCPKTILSGSEYFKCDHQRSVFLYMSSVNGSCPIIAYPCE 278

  Fly   290 RCGDYEEAVAKECGS---------SYSSVR 310
            ...|:::....:||.         .|.|||
Zfish   279 SYTDFQDGTCMDCGKFKSAGCPIFGYDSVR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 94/275 (34%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 94/279 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578559
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.