DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and LPL

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:295 Identity:91/295 - (30%)
Similarity:132/295 - (44%) Gaps:53/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 IKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWF---------THGDMNMIAVDWG 135
            |...:.|::..|||.:..|...||||:.:       |:.::|.         ...|.|:|.|||.
Human    57 IPGVAESVATCHFNHSSKTFMVIHGWTVT-------GMYESWVPKLVAALYKREPDSNVIVVDWL 114

  Fly   136 RARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHT 200
            ......|..|......||:.||..||:|.......|||..::|:|||||.:|.|| ::.|.:::.
Human   115 SRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAG-SLTNKKVNR 178

  Fly   201 IIGLDPALPLFSYDSPNKRLSSTDAYYVESIQT-----NGGTLGFLKPIGKGAFYPNGGKSQPGC 260
            |.|||||.|.|.|.....|||..||.:|:.:.|     .|.::|..||:|....|||||..||||
Human   179 ITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGC 243

  Fly   261 G---------------VDLTGSCAHSRSVIYYAESV--TENNFPTMRCGD---YEEAVAKECGSS 305
            .               ||....|:|.||:..:.:|:  .||.....||..   :|:.:...|..:
Human   244 NIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKN 308

  Fly   306 ------YSSVRMGATTNAYMVAGDYYVPVRSDAPY 334
                  |...::.|..::.|     |:..||..||
Human   309 RCNNLGYEINKVRAKRSSKM-----YLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 87/289 (30%)
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53
Lipase 33..473 CDD:332983 91/295 (31%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266 3/22 (14%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.