DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG10116

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:277 Identity:85/277 - (30%)
Similarity:131/277 - (47%) Gaps:23/277 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNMI 130
            |:|.|...:.:.|.|:|...::..|.|....||..||..|..:........|..|.....|.|:|
  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNII 88

  Fly   131 AVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKN 195
            :||...|..   .:.::      :.||:|:..:.:...:.||..:|:|.:.|||::|.....|:.
  Fly    89 SVDLSEAND---ETEII------DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQ 144

  Fly   196 G---QLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKSQ 257
            .   ||..|..|||:    |....:.:||..||.:||.:.||.|..|..:.:|...:|||||::|
  Fly   145 DLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQTQ 205

  Fly   258 PGCGVDLTGSCAHSRSVIYYAESVT-ENNFPTMRCGDYEEAVAKECGSSYSSVRMGATTNAYMVA 321
            |||..|   ||:|.|:....||..: ||:|.:.|||..|...|..|  .:|:.:||........|
  Fly   206 PGCTTD---SCSHERAFELLAEMWSPENDFVSARCGSVETLSASSC--RWSTHKMGQKQEEEQPA 265

  Fly   322 -GDYYVPVRSDAPYGMG 337
             |.|::..|..:|:..|
  Fly   266 SGIYFLETRQSSPFSRG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 82/268 (31%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 82/267 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445961
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.