DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG10357

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster


Alignment Length:308 Identity:103/308 - (33%)
Similarity:150/308 - (48%) Gaps:45/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NVLNPVTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFT 123
            ::||..|.|....|...|.:.::..|:..|         .:..:||:..|........:|:|:..
  Fly    25 SLLNQSTIYYLKPSADVSLENVEQLSSVES---------VKLIVHGYLGSCTHGSIMPLRNAYTA 80

  Fly   124 HGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGY 188
            .|..|::..|||...::||.||.|||..|.:.:|.|:......||::|:...|||||||||::|.
  Fly    81 QGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGR 145

  Fly   189 AGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNG 253
            .|:.. ||.|..:.||||||||||..|.:. |.|..|.:|:.|.|:....|.::|.|...||||.
  Fly   146 IGRYF-NGSLGRVTGLDPALPLFSSRSDDS-LHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNF 208

  Fly   254 GKS-QPGC-GVDLTG---------SCAHSRSVIYYAESV-TENNFPTMRCG-------DYEEAVA 299
            |.: |||| .||:..         ||:|:|:|::||||: ...|||.:.|.       ..|:.:.
  Fly   209 GLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLR 273

  Fly   300 K------ECGSSYSSVRMGATTN----AYMVAGDYYVPVRSDAPYGMG 337
            :      |..:.|.:|.||...|    .|     ||:......|||.|
  Fly   274 EKSKTNTENANDYQTVFMGEHVNRSATLY-----YYLETNGAPPYGQG 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 97/294 (33%)
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 98/295 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.