DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG13562

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:385 Identity:77/385 - (20%)
Similarity:127/385 - (32%) Gaps:106/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLF-----LALAFCVLAANAVEVRVNGENGWYVPQADGTMEWMDREFA-----EAYLETKN--- 53
            |:||     :.:..|||.                  .|||...::.::|     :|...|:|   
  Fly     1 MQLFSSFHSILIVCCVLL------------------IDGTHSKLNLKYAILRQKQAAKATQNDTL 47

  Fly    54 ------RMEGRNVLNPVTFYLYTNSNRNSPQEIKA--TSASISGSHFNPNHPTRFTIHGW-SSSK 109
                  :.:.:..:. |.||    .|.....|..|  .:..:|||..:|.......:||| .|..
  Fly    48 AHQQRIKYDAQKTMK-VMFY----KNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCS 107

  Fly   110 DEF-INYGVRDAWFTHGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDN 173
            ||: ::...|.:::..|  .:|.:|:....|..|.........:...::::| ......|.:...
  Fly   108 DEWALSLIERLSYYRGG--CVICIDYSVVASSSYMRLYTNFDTLTGAISSII-LTLFRQGFDPKR 169

  Fly   174 TMVIGHSLGAHVSGYAGKNVKNGQLHTII-----------GLDPALPLFSYDSPNKRL----SST 223
            ..:.|.|.|..::...|::::.   |.||           |.||.  ...:....|.:    ||.
  Fly   170 GYMFGFSFGGQLASAVGRSLRP---HHIIESIDTCDMAGPGFDPI--AVDHSKAGKHVQCFHSSR 229

  Fly   224 DAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKSQPGCGVDL-TGSCAHSRSVIYYAESVTENNFP 287
            |.          ||  |:....:.....:.|..||.....| .||  |...|..|.     |.| 
  Fly   230 DK----------GT--FVYSCHRNIMLGSCGLKQPSVASQLHLGS--HGLCVDIYI-----NTF- 274

  Fly   288 TMRCGDYE----EAVAKECGSSYSSVRM-GATTNAY------MVAGDYYVPVRSDAPYGM 336
                 ||.    .....||.:...:.:: ...|..|      .|.|..:||.....||.:
  Fly   275 -----DYPFYAVNYTPPECFTWQKTAKIPDGYTVGYEENFDSQVTGQIFVPTSLHYPYNL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 62/296 (21%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 30/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.