DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG6431

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:309 Identity:90/309 - (29%)
Similarity:136/309 - (44%) Gaps:46/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EWMDREFAEAYLETKN---RMEGRNVLNPVTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTR 99
            |...:.|.:..|.|.|   |....||.||:|.|                    .|. |:.:..|.
  Fly    54 ETCPKRFIDYQLFTSNGPRRGTPLNVKNPITLY--------------------KGG-FSKHRETV 97

  Fly   100 FTIHGWSSSKDEFINYGVRDAWFTHGDMNMIAVDW-GRARSVDYASSVLAVPGVGEQVATLINFM 163
            |.|||::.:..:.....:|||:.:. |.|:|.||| ...|...|..|::......:..|.:..|:
  Fly    98 FIIHGFNGTAIDIHLQFLRDAYLSR-DFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFL 161

  Fly   164 RSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNK-RLSSTDAYY 227
             :::|...:....:|||||||:.|....::...| :.|||||||.||......|| |||..||..
  Fly   162 -THYGAVRERITCVGHSLGAHICGMISNHLTRKQ-YRIIGLDPARPLIERMKSNKFRLSIDDANV 224

  Fly   228 VESIQTNGGTLGFLKPIGKGAFYPNGGKSQPGC-GVDLTGS-CAHSRSVIYYAESVTENN-FPTM 289
            ::.:.||.|.||.....|...:..|||:.||.| |..:..| |:|..|:.|.|.:..::| |..:
  Fly   225 IQVLHTNAGFLGQEDNSGHLNYCVNGGRIQPFCKGNPIRKSRCSHFLSICYLATATFKHNKFMGV 289

  Fly   290 RCGDYEEAVAKECGSSYSSVRM--GATTNAYMVAG---DYYVPVRSDAP 333
            .|       ...|.:...|.|:  ....|.:..|.   :|:  :.:|||
  Fly   290 PC-------PNGCLNLSGSKRLPVSGKVNPFEFASLIREYH--IGNDAP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 77/275 (28%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.