DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG17292

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:279 Identity:77/279 - (27%)
Similarity:128/279 - (45%) Gaps:45/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNMIAVDWGRARSVDYASSVLAVPG 151
            :...|.:....|...:||:....|....:.:.:|:....|.|:|.:|||.....:|...  |.|.
  Fly    50 LEDEHLDLGKNTVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFD--AFPN 112

  Fly   152 ---VGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKN-----GQLHTIIGLDPAL 208
               :|.::|.::..| .:|||:::...::|||:|..::|..|:.:..     .::..|..||||.
  Fly   113 LKQLGPELAKVLLKM-FDHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAF 176

  Fly   209 PLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKS-QPGC---------GVD 263
            |||   .|...||:.||.:|:.|.|:....|.....|...|:||||.| ||||         ..|
  Fly   177 PLF---YPGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDND 238

  Fly   264 LTGSCAHSRSVIYYAESVTE------NNFPTMRCGDYEE-AVAKECGSSYSSVRMG---ATTNAY 318
            |:   :|.||..::||||::      :..|..:..|::: .:.:.|    ..|.||   .||   
  Fly   239 LS---SHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENC----PPVVMGHHCPTT--- 293

  Fly   319 MVAGDYYVPVRSDAPYGMG 337
             :.||:|:......|:..|
  Fly   294 -IHGDFYLQTNGHTPFARG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 75/270 (28%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 75/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.