DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG7367

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster


Alignment Length:355 Identity:114/355 - (32%)
Similarity:160/355 - (45%) Gaps:61/355 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EVRVNGEN---GW-YVPQADGTMEWMDREFAEAYL---ETKNRMEGRNVLNPVTFYLYTNSNRNS 76
            ||.:|.|:   .| |:|...|..|       .|||   ..:||:   |:...:.|.||.:.:.:|
  Fly    53 EVALNQEDYNKTWIYMPNGQGKPE-------VAYLVEPPPENRI---NLPQLIKFELYGSDSSSS 107

  Fly    77 ------------PQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNM 129
                        ||..|..:.......|||...|:..:|||.||........:|.|:...|.:|:
  Fly   108 ADFWIDENNFEFPQRHKRDTWQEMAEKFNPELDTKILVHGWKSSTMSNSIQSIRGAYIERGQVNV 172

  Fly   130 IAVDW-GRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNV 193
            .|::| .:|.::.|.:.......||..||.||:.:......:.:...:||||||||:.||||...
  Fly   173 FAINWKDQADNIYYLTPARYTVQVGRAVAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYT 237

  Fly   194 KNGQLHTIIGLDPALPLFSYD--SPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPN-GGK 255
            |. :::.|.|||||.|.|. |  .|...|..|||.:|:.|.:..|.|||.||||...|||| ||.
  Fly   238 KY-RVNRITGLDPARPAFE-DCIGPENHLDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGP 300

  Fly   256 SQPGC---GVDLTGSCAHSRSVIYYAESV-TENNFPTMRCGDYEEAVAKECGSSYSSVRMGATTN 316
            .||||   ....|| |:|.||..|||||: :...|..:.|...:|...|.|            |.
  Fly   301 PQPGCKELSQIFTG-CSHGRSYEYYAESINSPKGFYGVPCSGLDELKGKNC------------TG 352

  Fly   317 AYMVAGD---------YYVPVRSDAPYGMG 337
            ..::.||         ::|...:...|.:|
  Fly   353 GKILMGDPVPREARGIFFVKTANKPSYALG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 97/294 (33%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 93/273 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445971
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.