DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG14034

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:300 Identity:85/300 - (28%)
Similarity:144/300 - (48%) Gaps:15/300 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AYLETKNRMEGRNVLNP---VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSS 108
            |.|:..|....:|.:.|   ::|:|||..|:   :..|.:...::...|..:.|.:..|||::..
  Fly    18 AGLDDMNCFSLQNEICPNANISFWLYTKENQ---EGTKLSVFELNRFEFYHHKPLKVLIHGFNGH 79

  Fly   109 KDEFINYGVRDAWFTHGDMNMIAVDWGR-ARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLD 172
            :|...|..:|..:.|. |.|:|::|:.: |....|..:|.....|....|.|:..:..:..:.::
  Fly    80 RDFSPNTQLRPLFLTQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIE 143

  Fly   173 NTMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGT 237
            :..:||..|||||:|:.|:.:...:|..|..||||.|.:....|..:|..|||.:|:.:.|:...
  Fly   144 DLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTM 208

  Fly   238 LGFLKPIGKGAFYPNGGKSQPGCG----VDLTGSCAHSRSVIYYAESVTE-NNFPTMRCGDYEEA 297
            ||.|..:|...||.|.|.|||.||    :: |..|.|:|:..|||||::. :.|....|.:::..
  Fly   209 LGLLDAVGHVDFYLNMGVSQPNCGPINKME-THFCYHNRAADYYAESISSPSGFYGFYCPNFKSF 272

  Fly   298 VAKECGSSYSSVRMGATTNAYMVAGDYYVPVRSDAPYGMG 337
            ....|....:...||...:. ...|.|::...:..||..|
  Fly   273 AKGICIPDKNIELMGFHVDP-KARGRYFLDTNNGPPYAKG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 77/271 (28%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 77/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.