DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG18641

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:299 Identity:91/299 - (30%)
Similarity:143/299 - (47%) Gaps:40/299 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VTFYLYTNSNRNSPQEIKATSA-SISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDM 127
            :.|||||...:..|:.|..... ::..:||||.|||:..|||:...:....:..:|:|:|:.|:.
  Fly    70 IQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLREAYFSVGEY 134

  Fly   128 NMIAVDWGRARSVDYASSVLAVPGVGEQ-VATLINFM-RSNHGLNLDNTMVIGHSLGAHVSGYAG 190
            |:|.||:..|......|.:...|..|.. ::.|:.:: |...|:..|:...||:|:|||::|...
  Fly   135 NIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHIAGLVA 199

  Fly   191 KNVK--NGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNG 253
            ..:|  .|:|..|..|||.:..::..:.::.|.||||::|:.:.|..|.||.....|...||.||
  Fly   200 NYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHADFYVNG 264

  Fly   254 GKSQPGCGVDLTGS--------CAHSRSVIYYAESVTENNFPTMRCGDYEEAVAKECGSSYS--- 307
            |..||.|    .||        |.|::...|:.||:|     |.| |.|    |..|.:.:|   
  Fly   265 GTRQPAC----VGSATLFQTLACDHTKVTPYFIESIT-----TTR-GFY----AGPCPNLFSYLI 315

  Fly   308 ---------SVRMGATTNAYMVAGDYYVPVRSDAPYGMG 337
                     .|.||... ::...|:|||...:.||:..|
  Fly   316 GWCEPKDSEYVLMGEHC-SHKARGNYYVTTNAKAPFARG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 88/290 (30%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 88/290 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.