DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and Lipi

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_011244435.1 Gene:Lipi / 320355 MGIID:2443868 Length:485 Species:Mus musculus


Alignment Length:270 Identity:96/270 - (35%)
Similarity:141/270 - (52%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAW---FTHG 125
            :...:|:..|....:.:..::.|:: :.|||...|.:.|||:..       :|....|   ||..
Mouse    59 INLLMYSRGNAKCAEPLFESNNSLN-TRFNPAKKTVWIIHGYRP-------FGSTPVWLSRFTKA 115

  Fly   126 -----DMNMIAVDWGR-ARSVDYASSVLAVPGVGEQV-ATLINFMRSNHGLNLDNTMVIGHSLGA 183
                 |:|:|.|||.: |.:..|:.:|.....|.|.: .|:.|.:  .||.:|||...||.||||
Mouse   116 FLKQEDVNLIVVDWNQGATTFMYSRAVRNTRRVAEILRETIENLL--IHGASLDNFHFIGMSLGA 178

  Fly   184 HVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGA 248
            |:||:.|| :.:|||..|.|||||.|.||....|.||..|||.:|:.|.|:..:||..:|.|...
Mouse   179 HISGFVGK-IFHGQLGRITGLDPAGPQFSRKPSNSRLYYTDAKFVDVIHTDIKSLGIGEPSGHID 242

  Fly   249 FYPNGGKSQPGCGVDL-TGS----CAHSRSV-IYYAESVTENNFPTMRC---GDYEEAVAKECGS 304
            |||||||.||||...: :|:    |.|.|:: ::.|...|..||.:..|   .||:..:..:||:
Mouse   243 FYPNGGKHQPGCPTSIFSGTNFIKCDHQRAIYLFLAAFETSCNFVSFPCRSYKDYKNGLCVDCGN 307

  Fly   305 SY--SSVRMG 312
            .|  |..|:|
Mouse   308 LYKDSCPRLG 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 96/270 (36%)
LipiXP_011244435.1 Pancreat_lipase_like 57..346 CDD:238363 96/270 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835393
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.